Lineage for d3uxoa3 (3uxo A:149-334)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686016Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1686017Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1686025Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 1686026Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 1686171Species Norway rat (Rattus norvegicus) [TaxId:10116] [81576] (23 PDB entries)
  8. 1686174Domain d3uxoa3: 3uxo A:149-334 [250279]
    Other proteins in same PDB: d3uxoa1, d3uxoa2, d3uxob1, d3uxob2
    automated match to d4klia3

Details for d3uxoa3

PDB Entry: 3uxo (more details), 2.1 Å

PDB Description: Crystal Structure of Rat DNA Polymerase Beta Mutator I260Q Apoenzyme
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3uxoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uxoa3 d.218.1.2 (A:149-334) DNA polymerase beta, catalytic (31 kD) fragment {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlqpkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrs

SCOPe Domain Coordinates for d3uxoa3:

Click to download the PDB-style file with coordinates for d3uxoa3.
(The format of our PDB-style files is described here.)

Timeline for d3uxoa3: