SCOPe 2.08: Domain d3uxoa1: 3uxo A:10-91

Lineage for d3uxoa1 (3uxo A:10-91)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (15 PDB entries)

8. Domain d3uxoa1: 3uxo A:10-91 [250277]
   Other proteins in same PDB: d3uxoa2, d3uxoa3, d3uxob2, d3uxob3
   automated match to d1tv9a1

Details for d3uxoa1

PDB Entry: 3uxo, 2.1 Å

PDB Description: Crystal Structure of Rat DNA Polymerase Beta Mutator I260Q Apoenzyme

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3uxoa1:

Sequence; same for both SEQRES and ATOM records:

>d3uxoa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

Timeline for d3uxoa1:

• d3uxoa1 first appeared in SCOPe 2.04
  
• d3uxoa1 appears in SCOPe 2.07