| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
| Protein automated matches [191144] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189286] (20 PDB entries) |
| Domain d3uwna2: 3uwn A:314-419 [250274] automated match to d1oz2a2 complexed with unx, uwn |
PDB Entry: 3uwn (more details), 2.15 Å
SCOPe Domain Sequences for d3uwna2:
Sequence, based on SEQRES records: (download)
>d3uwna2 b.34.9.0 (A:314-419) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fswsqylrstraqaapkhlfvsqshsppplgfqvgmkleavdrmnpslvcvasvtdvvds
rflvhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdp
>d3uwna2 b.34.9.0 (A:314-419) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fswsqylrstraqaapkhlfvsppplgfqvgmkleavdrmnpslvcvasvtdvvdsrflv
hfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdp
Timeline for d3uwna2: