Lineage for d3uwna1 (3uwn A:204-313)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784802Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2784803Protein automated matches [191144] (3 species)
    not a true protein
  7. 2784818Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)
  8. 2784856Domain d3uwna1: 3uwn A:204-313 [250273]
    automated match to d1oz3a1
    complexed with unx, uwn

Details for d3uwna1

PDB Entry: 3uwn (more details), 2.15 Å

PDB Description: The 3-MBT repeat domain of L3MBTL1 in complex with a methyl-lysine mimic
PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein 1

SCOPe Domain Sequences for d3uwna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uwna1 b.34.9.0 (A:204-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ecwswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaev
cgyrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeee

SCOPe Domain Coordinates for d3uwna1:

Click to download the PDB-style file with coordinates for d3uwna1.
(The format of our PDB-style files is described here.)

Timeline for d3uwna1: