Lineage for d3uq2a1 (3uq2 A:253-328)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715906Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715907Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2716076Protein DNA polymerase lambda [101251] (1 species)
  7. 2716077Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)
  8. 2716086Domain d3uq2a1: 3uq2 A:253-328 [250255]
    Other proteins in same PDB: d3uq2a2, d3uq2a3
    automated match to d1rzta1
    protein/DNA complex; complexed with mg, na, ppv

Details for d3uq2a1

PDB Entry: 3uq2 (more details), 2.25 Å

PDB Description: Crystal structure of the post-catalytic product complex of polymerase lambda with an rCMP inserted opposite a templating G and dAMP inserted opposite a templating T at the primer terminus.
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3uq2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uq2a1 a.60.6.1 (A:253-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
nlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmaek
iieilesghlrkldhi

SCOPe Domain Coordinates for d3uq2a1:

Click to download the PDB-style file with coordinates for d3uq2a1.
(The format of our PDB-style files is described here.)

Timeline for d3uq2a1: