Lineage for d3uq0a2 (3uq0 A:329-385)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329532Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2329710Protein DNA polymerase lambda [101253] (1 species)
  7. 2329711Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)
  8. 2329719Domain d3uq0a2: 3uq0 A:329-385 [250253]
    Other proteins in same PDB: d3uq0a1, d3uq0a3
    automated match to d1xsna2
    protein/DNA complex; complexed with cl, edo, na, so4

Details for d3uq0a2

PDB Entry: 3uq0 (more details), 2.14 Å

PDB Description: Crystal structure of the post-catalytic product complex of polymerase lambda with an rAMP at the primer terminus.
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3uq0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uq0a2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d3uq0a2:

Click to download the PDB-style file with coordinates for d3uq0a2.
(The format of our PDB-style files is described here.)

Timeline for d3uq0a2: