SCOPe 2.08: Domain d3uq0a2: 3uq0 A:329-385

Lineage for d3uq0a2 (3uq0 A:329-385)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase lambda [101253] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101254] (27 PDB entries)

8. Domain d3uq0a2: 3uq0 A:329-385 [250253]
   Other proteins in same PDB: d3uq0a1, d3uq0a3
   automated match to d1xsna2
   protein/DNA complex; complexed with cl, edo, na, so4

Details for d3uq0a2

PDB Entry: 3uq0, 2.14 Å

PDB Description: Crystal structure of the post-catalytic product complex of polymerase lambda with an rAMP at the primer terminus.

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3uq0a2:

Sequence; same for both SEQRES and ATOM records:

>d3uq0a2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

Timeline for d3uq0a2:

• d3uq0a2 first appeared in SCOPe 2.04
  
• d3uq0a2 appears in SCOPe 2.07