Lineage for d3upqa2 (3upq A:329-385)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494216Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1494217Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1494393Protein DNA polymerase lambda [101253] (1 species)
  7. 1494394Species Human (Homo sapiens) [TaxId:9606] [101254] (25 PDB entries)
  8. 1494398Domain d3upqa2: 3upq A:329-385 [250249]
    Other proteins in same PDB: d3upqa1, d3upqa3
    automated match to d1xsna2
    protein/DNA complex; complexed with mn, na, so4, zan

Details for d3upqa2

PDB Entry: 3upq (more details), 1.95 Å

PDB Description: Crystal structure of the pre-catalytic ternary complex of polymerase lambda with an rATP analog opposite a templating T.
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3upqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3upqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d3upqa2:

Click to download the PDB-style file with coordinates for d3upqa2.
(The format of our PDB-style files is described here.)

Timeline for d3upqa2: