SCOPe 2.04: Domain d3up8a_: 3up8 A:

Lineage for d3up8a_ (3up8 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (23 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [256124] (1 PDB entry)

8. Domain d3up8a_: 3up8 A: [250246]
   automated match to d4fzia_
   complexed with act

Details for d3up8a_

PDB Entry: 3up8, 1.96 Å

PDB Description: Crystal structure of a putative 2,5-diketo-D-gluconic acid reductase B

PDB Compounds: (A:) Putative 2,5-diketo-D-gluconic acid reductase B

SCOPe Domain Sequences for d3up8a_:

Sequence; same for both SEQRES and ATOM records:

>d3up8a_ c.1.7.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
lyfqsmmhavssnganipalgfgtfrmsgaevlrilpqalklgfrhvdtaqiygneaevg
eaiqksgipradvflttkvwvdnyrhdafiasvdeslrklrtdhvdllllhwpgsdvpma
erigalnevrnagkvrhigisnfnttqmeeaarlsdapiatnqveyhpyldqtkvlqtar
rlgmsltsyyamangkvpadpllteiggrhgktaaqvalrwlvqqqdvivlsktatearl
kenfaifdfaltreemaavrelarpngrivnpqglapewda

Timeline for d3up8a_:

• d3up8a_ is new in SCOPe 2.04-stable
  
• d3up8a_ appears in SCOPe 2.05
  
• d3up8a_ appears in the current release, SCOPe 2.08, called d3up8a1