Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (23 species) not a true protein |
Species Sinorhizobium meliloti [TaxId:266834] [256124] (1 PDB entry) |
Domain d3up8a_: 3up8 A: [250246] automated match to d4fzia_ complexed with act |
PDB Entry: 3up8 (more details), 1.96 Å
SCOPe Domain Sequences for d3up8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3up8a_ c.1.7.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]} lyfqsmmhavssnganipalgfgtfrmsgaevlrilpqalklgfrhvdtaqiygneaevg eaiqksgipradvflttkvwvdnyrhdafiasvdeslrklrtdhvdllllhwpgsdvpma erigalnevrnagkvrhigisnfnttqmeeaarlsdapiatnqveyhpyldqtkvlqtar rlgmsltsyyamangkvpadpllteiggrhgktaaqvalrwlvqqqdvivlsktatearl kenfaifdfaltreemaavrelarpngrivnpqglapewda
Timeline for d3up8a_: