Lineage for d3umcd1 (3umc D:1-230)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920588Species Pseudomonas aeruginosa [TaxId:287] [256122] (1 PDB entry)
  8. 2920592Domain d3umcd1: 3umc D:1-230 [250244]
    Other proteins in same PDB: d3umca2, d3umcb2, d3umcc2, d3umcd2
    automated match to d2no4b_
    complexed with cl, na

Details for d3umcd1

PDB Entry: 3umc (more details), 2.15 Å

PDB Description: Crystal Structure of the L-2-Haloacid Dehalogenase PA0810
PDB Compounds: (D:) Haloacid dehalogenase

SCOPe Domain Sequences for d3umcd1:

Sequence, based on SEQRES records: (download)

>d3umcd1 c.108.1.0 (D:1-230) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mrailfdvfgtlvdwrsslieqfqalerelggtlpcveltdrwrqqykpamdrvrngqap
wqhldqlhrqslealagefglaldeallqritgfwhrlrpwpdtlagmhalkadywlaal
sngntalmldvarhaglpwdmllcadlfghykpdpqvylgacrlldlppqevmlcaahny
dlkaaralglktafiarpleygpgqsqdlaaeqdwdliasdlldlhrqla

Sequence, based on observed residues (ATOM records): (download)

>d3umcd1 c.108.1.0 (D:1-230) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mrailfdvfgtlvdwrsslieqfqalerelpcveltdrwrqqykpamdrvrngqapwqhl
dqlhrqslealagefglaldeallqritgfwhrlrpwpdtlagmhalkadywlaalsngn
talmldvarhaglpwdmllcadlfghykpdpqvylgacrlldlppqevmlcaahnydlka
aralglktafiarpleygpgqsqdlaaeqdwdliasdlldlhrqla

SCOPe Domain Coordinates for d3umcd1:

Click to download the PDB-style file with coordinates for d3umcd1.
(The format of our PDB-style files is described here.)

Timeline for d3umcd1: