SCOPe 2.07: Domain d3umcd1: 3umc D:1-230

Lineage for d3umcd1 (3umc D:1-230)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (53 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [256122] (1 PDB entry)

8. Domain d3umcd1: 3umc D:1-230 [250244]
   Other proteins in same PDB: d3umca2, d3umcb2, d3umcc2, d3umcd2
   automated match to d2no4b_
   complexed with cl, na

Details for d3umcd1

PDB Entry: 3umc, 2.15 Å

PDB Description: Crystal Structure of the L-2-Haloacid Dehalogenase PA0810

PDB Compounds: (D:) Haloacid dehalogenase

SCOPe Domain Sequences for d3umcd1:

Sequence, based on SEQRES records:

>d3umcd1 c.108.1.0 (D:1-230) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mrailfdvfgtlvdwrsslieqfqalerelggtlpcveltdrwrqqykpamdrvrngqap
wqhldqlhrqslealagefglaldeallqritgfwhrlrpwpdtlagmhalkadywlaal
sngntalmldvarhaglpwdmllcadlfghykpdpqvylgacrlldlppqevmlcaahny
dlkaaralglktafiarpleygpgqsqdlaaeqdwdliasdlldlhrqla

Sequence, based on observed residues (ATOM records):

>d3umcd1 c.108.1.0 (D:1-230) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mrailfdvfgtlvdwrsslieqfqalerelpcveltdrwrqqykpamdrvrngqapwqhl
dqlhrqslealagefglaldeallqritgfwhrlrpwpdtlagmhalkadywlaalsngn
talmldvarhaglpwdmllcadlfghykpdpqvylgacrlldlppqevmlcaahnydlka
aralglktafiarpleygpgqsqdlaaeqdwdliasdlldlhrqla

Timeline for d3umcd1:

• d3umcd1 first appeared in SCOPe 2.04, called d3umcd_
  
• d3umcd1 appears in SCOPe 2.06