Lineage for d3umca1 (3umc A:1-231)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527523Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2527524Protein automated matches [190447] (55 species)
    not a true protein
  7. 2527841Species Pseudomonas aeruginosa [TaxId:287] [256122] (1 PDB entry)
  8. 2527842Domain d3umca1: 3umc A:1-231 [250241]
    Other proteins in same PDB: d3umca2, d3umcb2, d3umcc2, d3umcd2
    automated match to d2no4b_
    complexed with cl, na

Details for d3umca1

PDB Entry: 3umc (more details), 2.15 Å

PDB Description: Crystal Structure of the L-2-Haloacid Dehalogenase PA0810
PDB Compounds: (A:) Haloacid dehalogenase

SCOPe Domain Sequences for d3umca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3umca1 c.108.1.0 (A:1-231) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mrailfdvfgtlvdwrsslieqfqalerelggtlpcveltdrwrqqykpamdrvrngqap
wqhldqlhrqslealagefglaldeallqritgfwhrlrpwpdtlagmhalkadywlaal
sngntalmldvarhaglpwdmllcadlfghykpdpqvylgacrlldlppqevmlcaahny
dlkaaralglktafiarpleygpgqsqdlaaeqdwdliasdlldlhrqlaa

SCOPe Domain Coordinates for d3umca1:

Click to download the PDB-style file with coordinates for d3umca1.
(The format of our PDB-style files is described here.)

Timeline for d3umca1: