SCOPe 2.04: Domain d3umca_: 3umc A:

Lineage for d3umca_ (3umc A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (45 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [256122] (1 PDB entry)

8. Domain d3umca_: 3umc A: [250241]
   automated match to d2no4b_
   complexed with cl, na

Details for d3umca_

PDB Entry: 3umc, 2.15 Å

PDB Description: Crystal Structure of the L-2-Haloacid Dehalogenase PA0810

PDB Compounds: (A:) Haloacid dehalogenase

SCOPe Domain Sequences for d3umca_:

Sequence; same for both SEQRES and ATOM records:

>d3umca_ c.108.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lyfqgmrailfdvfgtlvdwrsslieqfqalerelggtlpcveltdrwrqqykpamdrvr
ngqapwqhldqlhrqslealagefglaldeallqritgfwhrlrpwpdtlagmhalkady
wlaalsngntalmldvarhaglpwdmllcadlfghykpdpqvylgacrlldlppqevmlc
aahnydlkaaralglktafiarpleygpgqsqdlaaeqdwdliasdlldlhrqlaa

Timeline for d3umca_:

• d3umca_ is new in SCOPe 2.04-stable
  
• d3umca_ appears in SCOPe 2.05
  
• d3umca_ appears in the current release, SCOPe 2.08, called d3umca1