SCOPe 2.08: Domain d3uljb1: 3ulj B:27-114

Lineage for d3uljb1 (3ulj B:27-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [256121] (3 PDB entries)

8. Domain d3uljb1: 3ulj B:27-114 [250240]
   Other proteins in same PDB: d3uljb2
   automated match to d4a4ib_
   complexed with act, gol

Details for d3uljb1

PDB Entry: 3ulj, 1.06 Å

PDB Description: Crystal structure of apo Lin28B cold shock domain

PDB Compounds: (B:) Lin28b, DNA-binding protein

SCOPe Domain Sequences for d3uljb1:

Sequence; same for both SEQRES and ATOM records:

>d3uljb1 b.40.4.0 (B:27-114) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
dpqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepv
eftfkksskgfeslrvtgpggnpclgne

Timeline for d3uljb1:

• d3uljb1 first appeared in SCOPe 2.04, called d3uljb_
  
• d3uljb1 appears in SCOPe 2.07