Lineage for d3ulja_ (3ulj A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060461Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2060462Protein automated matches [190576] (33 species)
    not a true protein
  7. 2060645Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [256121] (3 PDB entries)
  8. 2060646Domain d3ulja_: 3ulj A: [250239]
    Other proteins in same PDB: d3uljb2
    automated match to d4a4ib_
    complexed with act, gol

Details for d3ulja_

PDB Entry: 3ulj (more details), 1.06 Å

PDB Description: Crystal structure of apo Lin28B cold shock domain
PDB Compounds: (A:) Lin28b, DNA-binding protein

SCOPe Domain Sequences for d3ulja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ulja_ b.40.4.0 (A:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
pqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepve
ftfkksskgfeslrvtgpggnpclgne

SCOPe Domain Coordinates for d3ulja_:

Click to download the PDB-style file with coordinates for d3ulja_.
(The format of our PDB-style files is described here.)

Timeline for d3ulja_: