Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (33 species) not a true protein |
Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [256121] (3 PDB entries) |
Domain d3ulja_: 3ulj A: [250239] Other proteins in same PDB: d3uljb2 automated match to d4a4ib_ complexed with act, gol |
PDB Entry: 3ulj (more details), 1.06 Å
SCOPe Domain Sequences for d3ulja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ulja_ b.40.4.0 (A:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} pqvlrgsghckwfnvrmgfgfismtsregsplenpvdvfvhqsklymegfrslkegepve ftfkksskgfeslrvtgpggnpclgne
Timeline for d3ulja_: