Lineage for d3ulfe_ (3ulf E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970849Species Vaucheria frigida [TaxId:195983] [256118] (2 PDB entries)
  8. 2970860Domain d3ulfe_: 3ulf E: [250236]
    automated match to d2z6da_
    complexed with fmn, po4

Details for d3ulfe_

PDB Entry: 3ulf (more details), 2.9 Å

PDB Description: the light state structure of the blue-light photoreceptor aureochrome1 lov
PDB Compounds: (E:) Aureochrome1

SCOPe Domain Sequences for d3ulfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ulfe_ d.110.3.0 (E:) automated matches {Vaucheria frigida [TaxId: 195983]}
edpdyslvkalqmaqqnfvitdaslpdnpivyasrgfltltgysldqilgrncrflqgpe
tdpravdkirnaitkgvdtsvcllnyrqdgttfwnlffvaglrdskgnivnyvgvqskvs
edyakllvneqniey

SCOPe Domain Coordinates for d3ulfe_:

Click to download the PDB-style file with coordinates for d3ulfe_.
(The format of our PDB-style files is described here.)

Timeline for d3ulfe_: