![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
![]() | Protein automated matches [190492] (24 species) not a true protein |
![]() | Species Vaucheria frigida [TaxId:195983] [256118] (2 PDB entries) |
![]() | Domain d3ulfe_: 3ulf E: [250236] automated match to d2z6da_ complexed with fmn, po4 |
PDB Entry: 3ulf (more details), 2.9 Å
SCOPe Domain Sequences for d3ulfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ulfe_ d.110.3.0 (E:) automated matches {Vaucheria frigida [TaxId: 195983]} edpdyslvkalqmaqqnfvitdaslpdnpivyasrgfltltgysldqilgrncrflqgpe tdpravdkirnaitkgvdtsvcllnyrqdgttfwnlffvaglrdskgnivnyvgvqskvs edyakllvneqniey
Timeline for d3ulfe_: