Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (24 species) not a true protein |
Species Vaucheria frigida [TaxId:195983] [256118] (2 PDB entries) |
Domain d3ulfd_: 3ulf D: [250235] automated match to d2z6da_ complexed with fmn, po4 |
PDB Entry: 3ulf (more details), 2.9 Å
SCOPe Domain Sequences for d3ulfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ulfd_ d.110.3.0 (D:) automated matches {Vaucheria frigida [TaxId: 195983]} yslvkalqmaqqnfvitdaslpdnpivyasrgfltltgysldqilgrncrflqgpetdpr avdkirnaitkgvdtsvcllnyrqdgttfwnlffvaglrdskgnivnyvgvqskvsedya kllvneqni
Timeline for d3ulfd_: