Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (13 species) not a true protein |
Species Saccharum officinarum [TaxId:4547] [256120] (2 PDB entries) |
Domain d3ul5c_: 3ul5 C: [250228] automated match to d3imad_ complexed with gol, na |
PDB Entry: 3ul5 (more details), 2.3 Å
SCOPe Domain Sequences for d3ul5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ul5c_ d.17.1.0 (C:) automated matches {Saccharum officinarum [TaxId: 4547]} dleaielarfavaehnsktnamleferlvkvrhqvvagtmhhftvqvkeagggkklyeak vwekvwenfkqlqsfqpv
Timeline for d3ul5c_: