Lineage for d3ukyb_ (3uky B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006377Protein Importin alpha [48376] (1 species)
  7. 2006378Species Mouse (Mus musculus) [TaxId:10090] [48377] (30 PDB entries)
  8. 2006385Domain d3ukyb_: 3uky B: [250222]
    automated match to d1un0b_

Details for d3ukyb_

PDB Entry: 3uky (more details), 2.35 Å

PDB Description: Mouse importin alpha: yeast CBP80 cNLS complex
PDB Compounds: (B:) Importin subunit alpha-2

SCOPe Domain Sequences for d3ukyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ukyb_ a.118.1.1 (B:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}
qgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgk
tdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgnia
gdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldave
qilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpiv
tpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqi
qqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnlls
akdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykasln
liekyfs

SCOPe Domain Coordinates for d3ukyb_:

Click to download the PDB-style file with coordinates for d3ukyb_.
(The format of our PDB-style files is described here.)

Timeline for d3ukyb_: