Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (20 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [233796] (3 PDB entries) |
Domain d3ukvc_: 3ukv C: [250221] automated match to d3ukna_ |
PDB Entry: 3ukv (more details), 2.7 Å
SCOPe Domain Sequences for d3ukvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ukvc_ b.82.3.0 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} yhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradiamhl nkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmevlkdn tvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglrevlrlypeyaqkfv seiqhdltynlre
Timeline for d3ukvc_: