Lineage for d1d1ic_ (1d1i C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110115Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 110116Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 110308Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)
  7. 110309Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)
  8. 110322Domain d1d1ic_: 1d1i C: [25022]

Details for d1d1ic_

PDB Entry: 1d1i (more details), 1.7 Å

PDB Description: mutated shiga-like toxin b subunit (w34a) complexed with receptor gb3 analogue

SCOP Domain Sequences for d1d1ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1ic_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d1d1ic_:

Click to download the PDB-style file with coordinates for d1d1ic_.
(The format of our PDB-style files is described here.)

Timeline for d1d1ic_: