Lineage for d3uktd_ (3ukt D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2071306Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2071539Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2071540Protein automated matches [226927] (14 species)
    not a true protein
  7. 2071608Species Zebrafish (Danio rerio) [TaxId:7955] [233796] (3 PDB entries)
  8. 2071615Domain d3uktd_: 3ukt D: [250218]
    automated match to d3ukna_

Details for d3uktd_

PDB Entry: 3ukt (more details), 2.3 Å

PDB Description: Structure of the C-linker/CNBHD of zELK channels in P1 21 1 space group
PDB Compounds: (D:) Novel protein similar to vertebrate potassium voltage-gated channel, subfamily H (Eag-related) family

SCOPe Domain Sequences for d3uktd_:

Sequence, based on SEQRES records: (download)

>d3uktd_ b.82.3.0 (D:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradiamh
lnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmevlkd
ntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglrevlrlypeyaqkf
vseiqhdltynl

Sequence, based on observed residues (ATOM records): (download)

>d3uktd_ b.82.3.0 (D:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
lyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradiamh
lnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmevlkd
ntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglrevlhdltynl

SCOPe Domain Coordinates for d3uktd_:

Click to download the PDB-style file with coordinates for d3uktd_.
(The format of our PDB-style files is described here.)

Timeline for d3uktd_: