SCOPe 2.08: Domain d3uiwb_: 3uiw B:

Lineage for d3uiwb_ (3uiw B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [256119] (1 PDB entry)

8. Domain d3uiwb_: 3uiw B: [250213]
   automated match to d1b4qa_
   complexed with gsh, so4

Details for d3uiwb_

PDB Entry: 3uiw, 2.6 Å

PDB Description: Zebrafish Grx2 (APO)

PDB Compounds: (B:) glutaredoxin 2

SCOPe Domain Sequences for d3uiwb_:

Sequence; same for both SEQRES and ATOM records:

>d3uiwb_ c.47.1.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
glsssacgqfvqdivssncvvifskttcpyckmakgvfneigatykvveldehndgrrlq
etlaeltgartvprvfingqcigggsdtkqlhqqgkllplieqcrpccl

Timeline for d3uiwb_:

• d3uiwb_ first appeared in SCOPe 2.04
  
• d3uiwb_ appears in SCOPe 2.07