Lineage for d3ufga_ (3ufg A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920896Protein automated matches [193659] (5 species)
    not a true protein
  7. 1920897Species Campylobacter jejuni [TaxId:197] [256056] (2 PDB entries)
  8. 1920900Domain d3ufga_: 3ufg A: [250210]
    automated match to d1j5wa_
    protein/RNA complex; complexed with atp, leu

Details for d3ufga_

PDB Entry: 3ufg (more details), 2.55 Å

PDB Description: The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP
PDB Compounds: (A:) Glycyl-tRNA synthetase alpha subunit

SCOPe Domain Sequences for d3ufga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ufga_ d.104.1.1 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
nlyfqsnamtfsqmilnlqnywqeqgcaimqpydmpagagtfhpatflrslgkkpwaaay
vapsrrptdgrygenpnrlgayyqfqvlikpspdniqelylkslenlgfdlkshdirfve
dnwespslgawglgwevwldgmevtqftyfqqvggiavdlvsaeitygleriamylqnvd
nvydivwsefngekikyadvhkqseyefskynfevsdvkilneqfensykecknileqgl
alpaydycmlaahtfnlldargaisvaqrqdymlkirelskncaeiykknln

SCOPe Domain Coordinates for d3ufga_:

Click to download the PDB-style file with coordinates for d3ufga_.
(The format of our PDB-style files is described here.)

Timeline for d3ufga_: