Lineage for d3ue9d_ (3ue9 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114014Species Burkholderia thailandensis [TaxId:271848] [196068] (4 PDB entries)
  8. 2114020Domain d3ue9d_: 3ue9 D: [250209]
    automated match to d4m0gb_
    complexed with act, ca, na

Details for d3ue9d_

PDB Entry: 3ue9 (more details), 1.95 Å

PDB Description: Crystal structure of Adenylosuccinate synthetase (AMPSase) (purA) from Burkholderia thailandensis
PDB Compounds: (D:) adenylosuccinate synthetase

SCOPe Domain Sequences for d3ue9d_:

Sequence, based on SEQRES records: (download)

>d3ue9d_ c.37.1.0 (D:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
vtpgrnvvvvgtqwgdegkgkivdwltdhaqgvvrfqgghnaghtliiggkktilrlips
gimregvacyigngvvlspealfkeigeleeaglsvrerlfiseattlilpyhiaidqar
earkgagkigttgrgigpayedkvgrralrvqdlfdartfadrlrenldfhnfvltqylg
gaavdfqatldtmlgyadrlrpmvadvsrrlyeenhagrnllfegaqgtlldidhgtypf
vtssncvagaaaagagvgpqklnyilgitkayctrvgsgpfpselydadnpsrqdqigit
lanvgkefgsvtgrprrtgwldaaalrrsiqingvsglcmtkldvldgldevklcvgyki
dgedadllprgaaevarcepvyetfggwkestvginswdalpanarayltrvqevagvpi
dmvstgpdrdetillrhpfkv

Sequence, based on observed residues (ATOM records): (download)

>d3ue9d_ c.37.1.0 (D:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
vtpgrnvvvvgtqwgdegkgkivdwltdhaqgvvrfqgghnaghtltilrlipsgimreg
vacyigngvvlspealfkeigeleeaglsvrerlfiseattlilpyhiaidqarearrgi
gpayedkvgrralrvqdlfdartfadrlrenldfhnfvltqylggaavdfqatldtmlgy
adrlrpmvadvsrrlyeenhagrnllfegaqgtlldidhgtypfvtssncvagaaaagag
vgpqklnyilgitkayctrvgsgpfpselydadnpsrqdqigitlanvgkefgsvtgrpr
rtgwldaaalrrsiqingvsglcmtkldvldgldevklcvgykidgedadllprgaaeva
rcepvyetfggwkestvginswdalpanarayltrvqevagvpidmvstgpdrdetillr
hpfkv

SCOPe Domain Coordinates for d3ue9d_:

Click to download the PDB-style file with coordinates for d3ue9d_.
(The format of our PDB-style files is described here.)

Timeline for d3ue9d_: