![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
![]() | Domain d3ubxd2: 3ubx D:186-279 [250191] Other proteins in same PDB: d3ubxa1, d3ubxa3, d3ubxb_, d3ubxd1, d3ubxd3, d3ubxe_, d3ubxi2, d3ubxl2 automated match to d3hujc2 complexed with 09n, nag |
PDB Entry: 3ubx (more details), 3.1 Å
SCOPe Domain Sequences for d3ubxd2:
Sequence, based on SEQRES records: (download)
>d3ubxd2 b.1.1.0 (D:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
>d3ubxd2 b.1.1.0 (D:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqat ldveageeaglacrvkhsslggqdiilyw
Timeline for d3ubxd2: