Lineage for d3ubxd2 (3ubx D:186-286)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520967Domain d3ubxd2: 3ubx D:186-286 [250191]
    Other proteins in same PDB: d3ubxa1, d3ubxb_, d3ubxd1, d3ubxe_, d3ubxi2, d3ubxl2
    automated match to d3hujc2
    complexed with 09n, nag

Details for d3ubxd2

PDB Entry: 3ubx (more details), 3.1 Å

PDB Description: crystal structure of the mouse cd1d-c20:2-agalcer-l363 mab fab complex
PDB Compounds: (D:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3ubxd2:

Sequence, based on SEQRES records: (download)

>d3ubxd2 b.1.1.0 (D:186-286) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilywhhhhhhh

Sequence, based on observed residues (ATOM records): (download)

>d3ubxd2 b.1.1.0 (D:186-286) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqat
ldveageeaglacrvkhsslggqdiilywhhhhhhh

SCOPe Domain Coordinates for d3ubxd2:

Click to download the PDB-style file with coordinates for d3ubxd2.
(The format of our PDB-style files is described here.)

Timeline for d3ubxd2: