SCOPe 2.08: Domain d3uame_: 3uam E:

Lineage for d3uame_ (3uam E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [256117] (1 PDB entry)

8. Domain d3uame_: 3uam E: [250182]
   automated match to d4a02a_
   complexed with gol, no3

Details for d3uame_

PDB Entry: 3uam, 2 Å

PDB Description: Crystal structure of a chitin binding domain from Burkholderia pseudomallei

PDB Compounds: (E:) Chitin binding domain

SCOPe Domain Sequences for d3uame_:

Sequence; same for both SEQRES and ATOM records:

>d3uame_ b.1.18.0 (E:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
vitpesravylyeagrldfgqvneleggkffpatqsglrdpdapddvangmpprdgeias
ggrtadaraqlnepdsvahwqkhavrsgqslqiswsysmphktrrwtywitkpgwdtqar
larahfepdplkvylntyqpywgpdadkelipqgetihefnlptrtgyhvllavwdvadt
anafyqvidlnfa

Timeline for d3uame_:

• d3uame_ first appeared in SCOPe 2.04
  
• d3uame_ appears in SCOPe 2.07