Lineage for d3uame_ (3uam E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766165Species Burkholderia pseudomallei [TaxId:320372] [256117] (1 PDB entry)
  8. 2766170Domain d3uame_: 3uam E: [250182]
    automated match to d4a02a_
    complexed with gol, no3

Details for d3uame_

PDB Entry: 3uam (more details), 2 Å

PDB Description: Crystal structure of a chitin binding domain from Burkholderia pseudomallei
PDB Compounds: (E:) Chitin binding domain

SCOPe Domain Sequences for d3uame_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uame_ b.1.18.0 (E:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
vitpesravylyeagrldfgqvneleggkffpatqsglrdpdapddvangmpprdgeias
ggrtadaraqlnepdsvahwqkhavrsgqslqiswsysmphktrrwtywitkpgwdtqar
larahfepdplkvylntyqpywgpdadkelipqgetihefnlptrtgyhvllavwdvadt
anafyqvidlnfa

SCOPe Domain Coordinates for d3uame_:

Click to download the PDB-style file with coordinates for d3uame_.
(The format of our PDB-style files is described here.)

Timeline for d3uame_: