![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species) phage-borne toxin; bacteriophages H30 and H19B |
![]() | Species Escherichia coli [TaxId:562] [50211] (15 PDB entries) |
![]() | Domain d1c48d_: 1c48 D: [25018] |
PDB Entry: 1c48 (more details), 1.6 Å
SCOPe Domain Sequences for d1c48d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c48d_ b.40.2.1 (D:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]} tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng gtfsevifr
Timeline for d1c48d_:
![]() Domains from other chains: (mouse over for more information) d1c48a_, d1c48b_, d1c48c_, d1c48e_ |