Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein multi-copper oxidase CueO [69194] (1 species) |
Species Escherichia coli [TaxId:562] [69195] (38 PDB entries) |
Domain d3uaea3: 3uae A:336-516 [250179] Other proteins in same PDB: d3uaea4 automated match to d3od3a3 complexed with act, cu, o; mutant |
PDB Entry: 3uae (more details), 1.3 Å
SCOPe Domain Sequences for d3uaea3:
Sequence, based on SEQRES records: (download)
>d3uaea3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahshllehqdtgmmlgft v
>d3uaea3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhhmnhggkfdfhhan kingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahrag wkdtvkvegnvsevlvkfnhdapkehaymahshllehqdtgmmlgftv
Timeline for d3uaea3: