Lineage for d3uaaa3 (3uaa A:336-516)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381153Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2381154Species Escherichia coli [TaxId:562] [69195] (38 PDB entries)
  8. 2381196Domain d3uaaa3: 3uaa A:336-516 [250167]
    Other proteins in same PDB: d3uaaa4
    automated match to d3od3a3
    complexed with act, cu, o; mutant

Details for d3uaaa3

PDB Entry: 3uaa (more details), 1.7 Å

PDB Description: Multicopper Oxidase CueO mutant C500SE506Q (data1)
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3uaaa3:

Sequence, based on SEQRES records: (download)

>d3uaaa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahshllehqdtgmmlgft
v

Sequence, based on observed residues (ATOM records): (download)

>d3uaaa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhhmnhggkfdfhhan
kingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahrag
wkdtvkvegnvsevlvkfnhdapkehaymahshllehqdtgmmlgftv

SCOPe Domain Coordinates for d3uaaa3:

Click to download the PDB-style file with coordinates for d3uaaa3.
(The format of our PDB-style files is described here.)

Timeline for d3uaaa3: