Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries) |
Domain d3u8zc3: 3u8z C:215-312 [250157] Other proteins in same PDB: d3u8za1, d3u8zb1, d3u8zc1, d3u8zc2, d3u8zd1 automated match to d2zpya2 |
PDB Entry: 3u8z (more details), 2.64 Å
SCOPe Domain Sequences for d3u8zc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u8zc3 b.55.1.0 (C:215-312) automated matches {Human (Homo sapiens) [TaxId: 9606]} emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik pldkkidvfkfnssklrvnklilqlcignhdlfmrrrk
Timeline for d3u8zc3: