Lineage for d3u8zc3 (3u8z C:215-312)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799421Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1799422Protein automated matches [190052] (5 species)
    not a true protein
  7. 1799448Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)
  8. 1799469Domain d3u8zc3: 3u8z C:215-312 [250157]
    Other proteins in same PDB: d3u8za1, d3u8zb1, d3u8zc1, d3u8zc2, d3u8zd1
    automated match to d2zpya2

Details for d3u8zc3

PDB Entry: 3u8z (more details), 2.64 Å

PDB Description: human merlin ferm domain
PDB Compounds: (C:) merlin

SCOPe Domain Sequences for d3u8zc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u8zc3 b.55.1.0 (C:215-312) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrrk

SCOPe Domain Coordinates for d3u8zc3:

Click to download the PDB-style file with coordinates for d3u8zc3.
(The format of our PDB-style files is described here.)

Timeline for d3u8zc3: