![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
![]() | Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
![]() | Protein automated matches [254423] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255207] (60 PDB entries) |
![]() | Domain d3u8zc2: 3u8z C:104-214 [250156] Other proteins in same PDB: d3u8za1, d3u8za2, d3u8zb1, d3u8zb2, d3u8zc1, d3u8zc3, d3u8zd1, d3u8zd2 automated match to d2zpya1 |
PDB Entry: 3u8z (more details), 2.64 Å
SCOPe Domain Sequences for d3u8zc2:
Sequence, based on SEQRES records: (download)
>d3u8zc2 a.11.2.0 (C:104-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl
>d3u8zc2 a.11.2.0 (C:104-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhqmtpe mweeritawyaehrgrardeaemeylkiaqdl
Timeline for d3u8zc2: