Lineage for d3u8zc2 (3u8z C:104-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697545Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2697546Protein automated matches [254423] (5 species)
    not a true protein
  7. 2697553Species Human (Homo sapiens) [TaxId:9606] [255207] (60 PDB entries)
  8. 2697617Domain d3u8zc2: 3u8z C:104-214 [250156]
    Other proteins in same PDB: d3u8za1, d3u8za2, d3u8zb1, d3u8zb2, d3u8zc1, d3u8zc3, d3u8zd1, d3u8zd2
    automated match to d2zpya1

Details for d3u8zc2

PDB Entry: 3u8z (more details), 2.64 Å

PDB Description: human merlin ferm domain
PDB Compounds: (C:) merlin

SCOPe Domain Sequences for d3u8zc2:

Sequence, based on SEQRES records: (download)

>d3u8zc2 a.11.2.0 (C:104-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

Sequence, based on observed residues (ATOM records): (download)

>d3u8zc2 a.11.2.0 (C:104-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhqmtpe
mweeritawyaehrgrardeaemeylkiaqdl

SCOPe Domain Coordinates for d3u8zc2:

Click to download the PDB-style file with coordinates for d3u8zc2.
(The format of our PDB-style files is described here.)

Timeline for d3u8zc2: