SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3u88d_ (3u88 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997956Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 1998036Superfamily a.48.4: HIV integrase-binding domain [140576] (1 family) (S)
  5. 1998037Family a.48.4.1: HIV integrase-binding domain [140577] (2 protein domains)
    N-terminal part of PfamB PB012949
  6. 1998043Protein automated matches [191076] (1 species)
    not a true protein
  7. 1998044Species Human (Homo sapiens) [TaxId:9606] [188992] (3 PDB entries)
  8. 1998050Domain d3u88d_: 3u88 D: [250150]
    Other proteins in same PDB: d3u88a1, d3u88a2, d3u88b1, d3u88b2
    automated match to d3hphe_
    complexed with 0br, chd, ggb, glv, so4

Details for d3u88d_

PDB Entry: 3u88 (more details), 3 Å

PDB Description: crystal structure of human menin in complex with mll1 and ledgf
PDB Compounds: (D:) Lens epithelium-derived growth factor

SCOPe Domain Sequences for d3u88d_:

Sequence, based on SEQRES records: (download)

>d3u88d_ a.48.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfkvsqvi
mekstmlynkfknmflvg

Sequence, based on observed residues (ATOM records): (download)

>d3u88d_ a.48.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrihaeiknslvnrciealdelaslqvtmqqaqkhtemittlkkirqvimekstmlynkf
knmflvg

SCOPe Domain Coordinates for d3u88d_:

Click to download the PDB-style file with coordinates for d3u88d_.
(The format of our PDB-style files is described here.)

Timeline for d3u88d_: