![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
![]() | Superfamily a.48.4: HIV integrase-binding domain [140576] (2 families) ![]() |
![]() | Family a.48.4.1: HIV integrase-binding domain [140577] (2 proteins) N-terminal part of PfamB PB012949 |
![]() | Protein automated matches [191076] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188992] (6 PDB entries) |
![]() | Domain d3u88d_: 3u88 D: [250150] Other proteins in same PDB: d3u88a1, d3u88a2, d3u88b1, d3u88b2 automated match to d3hphe_ complexed with 0br, chd, ggb, glv, so4 |
PDB Entry: 3u88 (more details), 3 Å
SCOPe Domain Sequences for d3u88d_:
Sequence, based on SEQRES records: (download)
>d3u88d_ a.48.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfkvsqvi mekstmlynkfknmflvg
>d3u88d_ a.48.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qrihaeiknslvnrciealdelaslqvtmqqaqkhtemittlkkirqvimekstmlynkf knmflvg
Timeline for d3u88d_: