Lineage for d3u88d_ (3u88 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714566Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2714663Superfamily a.48.4: HIV integrase-binding domain [140576] (2 families) (S)
  5. 2714664Family a.48.4.1: HIV integrase-binding domain [140577] (2 proteins)
    N-terminal part of PfamB PB012949
  6. 2714670Protein automated matches [191076] (1 species)
    not a true protein
  7. 2714671Species Human (Homo sapiens) [TaxId:9606] [188992] (6 PDB entries)
  8. 2714688Domain d3u88d_: 3u88 D: [250150]
    Other proteins in same PDB: d3u88a1, d3u88a2, d3u88b1, d3u88b2
    automated match to d3hphe_
    complexed with 0br, chd, ggb, glv, so4

Details for d3u88d_

PDB Entry: 3u88 (more details), 3 Å

PDB Description: crystal structure of human menin in complex with mll1 and ledgf
PDB Compounds: (D:) Lens epithelium-derived growth factor

SCOPe Domain Sequences for d3u88d_:

Sequence, based on SEQRES records: (download)

>d3u88d_ a.48.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrihaeiknslkidnldvnrciealdelaslqvtmqqaqkhtemittlkkirrfkvsqvi
mekstmlynkfknmflvg

Sequence, based on observed residues (ATOM records): (download)

>d3u88d_ a.48.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrihaeiknslvnrciealdelaslqvtmqqaqkhtemittlkkirqvimekstmlynkf
knmflvg

SCOPe Domain Coordinates for d3u88d_:

Click to download the PDB-style file with coordinates for d3u88d_.
(The format of our PDB-style files is described here.)

Timeline for d3u88d_: