Lineage for d3u74u1 (3u74 U:1-80)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032490Family g.7.1.0: automated matches [191613] (1 protein)
    not a true family
  6. 3032491Protein automated matches [191119] (7 species)
    not a true protein
  7. 3032499Species Human (Homo sapiens) [TaxId:9606] [256115] (2 PDB entries)
  8. 3032500Domain d3u74u1: 3u74 U:1-80 [250142]
    automated match to d2i9be2
    complexed with nag; mutant

Details for d3u74u1

PDB Entry: 3u74 (more details), 2.39 Å

PDB Description: crystal structure of stabilized human upar mutant
PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d3u74u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u74u1 g.7.1.0 (U:1-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrcmqcktngdcrveecalgqdlcrttivrlweegeelelveksctcsektnrtlsyrtg
lkitsltevvcgldlcnqgn

SCOPe Domain Coordinates for d3u74u1:

Click to download the PDB-style file with coordinates for d3u74u1.
(The format of our PDB-style files is described here.)

Timeline for d3u74u1: