Lineage for d1c4qe_ (1c4q E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398212Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 2398219Species Escherichia coli [TaxId:562] [50211] (15 PDB entries)
  8. 2398239Domain d1c4qe_: 1c4q E: [25014]
    complexed with bgc, gal, gla

Details for d1c4qe_

PDB Entry: 1c4q (more details), 1.52 Å

PDB Description: mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue
PDB Compounds: (E:) protein (shiga-like toxin I subunit b)

SCOPe Domain Sequences for d1c4qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4qe_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelatnranlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1c4qe_:

Click to download the PDB-style file with coordinates for d1c4qe_.
(The format of our PDB-style files is described here.)

Timeline for d1c4qe_: