Lineage for d3u6xp2 (3u6x P:63-164)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1531828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1531982Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. 1531999Protein automated matches [232461] (1 species)
    not a true protein
  7. 1532000Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries)
  8. 1532024Domain d3u6xp2: 3u6x P:63-164 [250132]
    Other proteins in same PDB: d3u6xa1, d3u6xb1, d3u6xc1, d3u6xd1, d3u6xe1, d3u6xf1, d3u6xg1, d3u6xh1, d3u6xi1, d3u6xj1, d3u6xk1, d3u6xl1, d3u6xm1, d3u6xn1, d3u6xo1, d3u6xp1, d3u6xq1, d3u6xr1
    automated match to d2f0ca1
    complexed with br

Details for d3u6xp2

PDB Entry: 3u6x (more details), 2.6 Å

PDB Description: Phage TP901-1 baseplate tripod
PDB Compounds: (P:) bpp

SCOPe Domain Sequences for d3u6xp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u6xp2 b.21.1.3 (P:63-164) automated matches {Lactococcus phage [TaxId: 35345]}
ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv
ghmvggwnafhidipssgvcqwfgptassgtprgtgtypidh

SCOPe Domain Coordinates for d3u6xp2:

Click to download the PDB-style file with coordinates for d3u6xp2.
(The format of our PDB-style files is described here.)

Timeline for d3u6xp2: