![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
![]() | Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins) automatically mapped to Pfam PF08932 |
![]() | Protein automated matches [232461] (1 species) not a true protein |
![]() | Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries) |
![]() | Domain d3u6xp2: 3u6x P:63-163 [250132] Other proteins in same PDB: d3u6xa1, d3u6xa3, d3u6xb1, d3u6xb3, d3u6xc1, d3u6xc3, d3u6xd1, d3u6xd3, d3u6xe1, d3u6xe3, d3u6xf1, d3u6xf3, d3u6xg1, d3u6xg3, d3u6xh1, d3u6xh3, d3u6xi1, d3u6xi3, d3u6xj1, d3u6xj3, d3u6xk1, d3u6xk3, d3u6xl1, d3u6xl3, d3u6xm1, d3u6xm3, d3u6xn1, d3u6xn3, d3u6xo1, d3u6xo3, d3u6xp1, d3u6xp3, d3u6xq1, d3u6xq3, d3u6xr1, d3u6xr3 automated match to d2f0ca1 complexed with br |
PDB Entry: 3u6x (more details), 2.6 Å
SCOPe Domain Sequences for d3u6xp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u6xp2 b.21.1.3 (P:63-163) automated matches {Lactococcus phage [TaxId: 35345]} ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid
Timeline for d3u6xp2:
![]() Domains from other chains: (mouse over for more information) d3u6xa1, d3u6xa2, d3u6xa3, d3u6xb1, d3u6xb2, d3u6xb3, d3u6xc1, d3u6xc2, d3u6xc3, d3u6xd1, d3u6xd2, d3u6xd3, d3u6xe1, d3u6xe2, d3u6xe3, d3u6xf1, d3u6xf2, d3u6xf3, d3u6xg1, d3u6xg2, d3u6xg3, d3u6xh1, d3u6xh2, d3u6xh3, d3u6xi1, d3u6xi2, d3u6xi3, d3u6xj1, d3u6xj2, d3u6xj3, d3u6xk1, d3u6xk2, d3u6xk3, d3u6xl1, d3u6xl2, d3u6xl3, d3u6xm1, d3u6xm2, d3u6xm3, d3u6xn1, d3u6xn2, d3u6xn3, d3u6xo1, d3u6xo2, d3u6xo3, d3u6xq1, d3u6xq2, d3u6xq3, d3u6xr1, d3u6xr2, d3u6xr3 |