SCOPe 2.05: Domain d3u6xm1: 3u6x M:2-62

Lineage for d3u6xm1 (3u6x M:2-62)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
   (homo)trimer; each chain donates 3 beta-strands per turn of the helix

4. Superfamily b.108.1: Phage fibre proteins [69349] (6 families)

5. Family b.108.1.0: automated matches [231970] (1 protein)
   not a true family

6. Protein automated matches [231971] (3 species)
   not a true protein

7. Species Lactococcus phage [TaxId:35345] [231972] (5 PDB entries)

8. Domain d3u6xm1: 3u6x M:2-62 [250125]
   Other proteins in same PDB: d3u6xa2, d3u6xb2, d3u6xc2, d3u6xd2, d3u6xe2, d3u6xf2, d3u6xg2, d3u6xh2, d3u6xi2, d3u6xj2, d3u6xk2, d3u6xl2, d3u6xm2, d3u6xn2, d3u6xo2, d3u6xp2, d3u6xq2, d3u6xr2
   automated match to d2f0ca2
   complexed with br

Details for d3u6xm1

PDB Entry: 3u6x, 2.6 Å

PDB Description: Phage TP901-1 baseplate tripod

PDB Compounds: (M:) bpp

SCOPe Domain Sequences for d3u6xm1:

Sequence; same for both SEQRES and ATOM records:

>d3u6xm1 b.108.1.0 (M:2-62) automated matches {Lactococcus phage [TaxId: 35345]}
asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
l

Timeline for d3u6xm1:

• d3u6xm1 first appeared in SCOPe 2.04
  
• d3u6xm1 appears in SCOPe 2.06
  
• d3u6xm1 appears in the current release, SCOPe 2.08