Lineage for d3u6xk1 (3u6x K:2-62)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1811802Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 1811803Superfamily b.108.1: Phage fibre proteins [69349] (6 families) (S)
  5. 1811850Family b.108.1.0: automated matches [231970] (1 protein)
    not a true family
  6. 1811851Protein automated matches [231971] (3 species)
    not a true protein
  7. 1811863Species Lactococcus phage [TaxId:35345] [231972] (5 PDB entries)
  8. 1811880Domain d3u6xk1: 3u6x K:2-62 [250121]
    Other proteins in same PDB: d3u6xa2, d3u6xb2, d3u6xc2, d3u6xd2, d3u6xe2, d3u6xf2, d3u6xg2, d3u6xh2, d3u6xi2, d3u6xj2, d3u6xk2, d3u6xl2, d3u6xm2, d3u6xn2, d3u6xo2, d3u6xp2, d3u6xq2, d3u6xr2
    automated match to d2f0ca2
    complexed with br

Details for d3u6xk1

PDB Entry: 3u6x (more details), 2.6 Å

PDB Description: Phage TP901-1 baseplate tripod
PDB Compounds: (K:) bpp

SCOPe Domain Sequences for d3u6xk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u6xk1 b.108.1.0 (K:2-62) automated matches {Lactococcus phage [TaxId: 35345]}
asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
l

SCOPe Domain Coordinates for d3u6xk1:

Click to download the PDB-style file with coordinates for d3u6xk1.
(The format of our PDB-style files is described here.)

Timeline for d3u6xk1: