Lineage for d3u6xg2 (3u6x G:63-163)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777048Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. 2777065Protein automated matches [232461] (1 species)
    not a true protein
  7. 2777066Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries)
  8. 2777081Domain d3u6xg2: 3u6x G:63-163 [250114]
    Other proteins in same PDB: d3u6xa1, d3u6xa3, d3u6xb1, d3u6xb3, d3u6xc1, d3u6xc3, d3u6xd1, d3u6xd3, d3u6xe1, d3u6xe3, d3u6xf1, d3u6xf3, d3u6xg1, d3u6xg3, d3u6xh1, d3u6xh3, d3u6xi1, d3u6xi3, d3u6xj1, d3u6xj3, d3u6xk1, d3u6xk3, d3u6xl1, d3u6xl3, d3u6xm1, d3u6xm3, d3u6xn1, d3u6xn3, d3u6xo1, d3u6xo3, d3u6xp1, d3u6xp3, d3u6xq1, d3u6xq3, d3u6xr1, d3u6xr3
    automated match to d2f0ca1
    complexed with br

Details for d3u6xg2

PDB Entry: 3u6x (more details), 2.6 Å

PDB Description: Phage TP901-1 baseplate tripod
PDB Compounds: (G:) bpp

SCOPe Domain Sequences for d3u6xg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u6xg2 b.21.1.3 (G:63-163) automated matches {Lactococcus phage [TaxId: 35345]}
ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv
ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid

SCOPe Domain Coordinates for d3u6xg2:

Click to download the PDB-style file with coordinates for d3u6xg2.
(The format of our PDB-style files is described here.)

Timeline for d3u6xg2:

View in 3D
Domains from other chains:
(mouse over for more information)
d3u6xa1, d3u6xa2, d3u6xa3, d3u6xb1, d3u6xb2, d3u6xb3, d3u6xc1, d3u6xc2, d3u6xc3, d3u6xd1, d3u6xd2, d3u6xd3, d3u6xe1, d3u6xe2, d3u6xe3, d3u6xf1, d3u6xf2, d3u6xf3, d3u6xh1, d3u6xh2, d3u6xh3, d3u6xi1, d3u6xi2, d3u6xi3, d3u6xj1, d3u6xj2, d3u6xj3, d3u6xk1, d3u6xk2, d3u6xk3, d3u6xl1, d3u6xl2, d3u6xl3, d3u6xm1, d3u6xm2, d3u6xm3, d3u6xn1, d3u6xn2, d3u6xn3, d3u6xo1, d3u6xo2, d3u6xo3, d3u6xp1, d3u6xp2, d3u6xp3, d3u6xq1, d3u6xq2, d3u6xq3, d3u6xr1, d3u6xr2, d3u6xr3