| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
| Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species) phage-borne toxin; bacteriophages H30 and H19B |
| Species Escherichia coli [TaxId:562] [50211] (13 PDB entries) |
| Domain d1c4qb_: 1c4q B: [25011] |
PDB Entry: 1c4q (more details), 1.52 Å
SCOP Domain Sequences for d1c4qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4qb_ b.40.2.1 (B:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelatnranlqslllsaqitgmtvtiktnachng
ggfsevifr
Timeline for d1c4qb_:
View in 3DDomains from other chains: (mouse over for more information) d1c4qa_, d1c4qc_, d1c4qd_, d1c4qe_ |