Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (16 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [256111] (3 PDB entries) |
Domain d3u6kb2: 3u6k B:205-296 [250099] Other proteins in same PDB: d3u6ka1, d3u6ka3, d3u6kb1, d3u6kb3 automated match to d1efca1 complexed with gdp, mg |
PDB Entry: 3u6k (more details), 2.45 Å
SCOPe Domain Sequences for d3u6kb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u6kb2 b.43.3.0 (B:205-296) automated matches {Escherichia coli K-12 [TaxId: 83333]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d3u6kb2: