Lineage for d3u6kb2 (3u6k B:205-296)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544344Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1544345Protein automated matches [226946] (16 species)
    not a true protein
  7. 1544372Species Escherichia coli K-12 [TaxId:83333] [256111] (3 PDB entries)
  8. 1544376Domain d3u6kb2: 3u6k B:205-296 [250099]
    Other proteins in same PDB: d3u6ka1, d3u6ka3, d3u6kb1, d3u6kb3
    automated match to d1efca1
    complexed with gdp, mg

Details for d3u6kb2

PDB Entry: 3u6k (more details), 2.45 Å

PDB Description: Ef-tu (escherichia coli) in complex with nvp-ldk733
PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d3u6kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u6kb2 b.43.3.0 (B:205-296) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d3u6kb2:

Click to download the PDB-style file with coordinates for d3u6kb2.
(The format of our PDB-style files is described here.)

Timeline for d3u6kb2: