SCOPe 2.07: Domain d3u6kb1: 3u6k B:8-204

Lineage for d3u6kb1 (3u6k B:8-204)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256110] (3 PDB entries)

8. Domain d3u6kb1: 3u6k B:8-204 [250098]
   Other proteins in same PDB: d3u6ka2, d3u6ka3, d3u6kb2, d3u6kb3
   automated match to d1d8ta3
   complexed with gdp, mg

Details for d3u6kb1

PDB Entry: 3u6k, 2.45 Å

PDB Description: Ef-tu (escherichia coli) in complex with nvp-ldk733

PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d3u6kb1:

Sequence; same for both SEQRES and ATOM records:

>d3u6kb1 c.37.1.8 (B:8-204) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

Timeline for d3u6kb1:

• d3u6kb1 first appeared in SCOPe 2.04
  
• d3u6kb1 appears in SCOPe 2.06
  
• d3u6kb1 appears in the current release, SCOPe 2.08