SCOPe 2.04: Domain d3u6ka3: 3u6k A:297-393

Lineage for d3u6ka3 (3u6k A:297-393)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.0: automated matches [254194] (1 protein)
   not a true family

6. Protein automated matches [254425] (11 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256112] (3 PDB entries)

8. Domain d3u6ka3: 3u6k A:297-393 [250097]
   Other proteins in same PDB: d3u6ka1, d3u6ka2, d3u6kb1, d3u6kb2
   automated match to d1d8ta2
   complexed with gdp, mg

Details for d3u6ka3

PDB Entry: 3u6k, 2.45 Å

PDB Description: Ef-tu (escherichia coli) in complex with nvp-ldk733

PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d3u6ka3:

Sequence; same for both SEQRES and ATOM records:

>d3u6ka3 b.44.1.0 (A:297-393) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

Timeline for d3u6ka3:

• d3u6ka3 is new in SCOPe 2.04-stable
  
• d3u6ka3 appears in SCOPe 2.05
  
• d3u6ka3 appears in the current release, SCOPe 2.08