Lineage for d3u6fb_ (3u6f B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887472Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries)
  8. 2887487Domain d3u6fb_: 3u6f B: [250094]
    automated match to d2oa8b_
    protein/DNA complex; complexed with bu1, mg; mutant

Details for d3u6fb_

PDB Entry: 3u6f (more details), 2.3 Å

PDB Description: Mouse TREX1 D200N mutant
PDB Compounds: (B:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d3u6fb_:

Sequence, based on SEQRES records: (download)

>d3u6fb_ c.55.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
phghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdk
lslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahng
drydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrl
ywqaptdshtaegnvltllsicqwkpqallqwvdeharpfstvkpmygtp

Sequence, based on observed residues (ATOM records): (download)

>d3u6fb_ c.55.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
phghmqtlifldleatglpssrpevtelcllavhrralisqghpppvprpprvvdklslc
iapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdryd
fpllqtelarlstpspldgtfcvdsiaalkaleqasksyslgsiytrlywqaptdshtae
gnvltllsicqwkpqallqwvdeharpfstvkpmygtp

SCOPe Domain Coordinates for d3u6fb_:

Click to download the PDB-style file with coordinates for d3u6fb_.
(The format of our PDB-style files is described here.)

Timeline for d3u6fb_: