SCOPe 2.08: Domain d3u6fa_: 3u6f A:

Lineage for d3u6fa_ (3u6f A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187264] (6 PDB entries)

8. Domain d3u6fa_: 3u6f A: [250093]
   automated match to d2oa8b_
   protein/DNA complex; complexed with bu1, mg; mutant

Details for d3u6fa_

PDB Entry: 3u6f, 2.3 Å

PDB Description: Mouse TREX1 D200N mutant

PDB Compounds: (A:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d3u6fa_:

Sequence, based on SEQRES records:

>d3u6fa_ c.55.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
phghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdk
lslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahng
drydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrl
ywqaptdshtaegnvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records):

>d3u6fa_ c.55.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
phghmqtlifldleatglpssrpevtelcllavhrralensqghpppvprpprvvdklsl
ciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdry
dfpllqtelarlstpspldgtfcvdsiaalkaleqarksyslgsiytrlywqaptdshta
egnvltllsicqwkpqallqwvdeharpfstvkpmyg

Timeline for d3u6fa_:

• d3u6fa_ first appeared in SCOPe 2.04
  
• d3u6fa_ appears in SCOPe 2.07