SCOP 1.63: Domain d1xtch_: 1xtc H:

Lineage for d1xtch_ (1xtc H:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Cholera toxin [50208] (1 species)
   barrel, partly opened; n*=5, S*=10

7. Species Vibrio cholerae [TaxId:666] [50209] (12 PDB entries)

8. Domain d1xtch_: 1xtc H: [25009]
   Other proteins in same PDB: d1xtc.1

Details for d1xtch_

PDB Entry: 1xtc, 2.4 Å

PDB Description: cholera toxin

SCOP Domain Sequences for d1xtch_:

Sequence; same for both SEQRES and ATOM records:

>d1xtch_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
qkkaiermkdtlriaylteakveklctwnnktphaiaaisman

Timeline for d1xtch_:

• d1xtch_ first appeared (with stable ids) in SCOP 1.55
  
• d1xtch_ appears in SCOP 1.61
  
• d1xtch_ appears in SCOP 1.65
  
• d1xtch_ appears in the current release, SCOPe 2.08