![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
![]() | Protein automated matches [254425] (11 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [256112] (3 PDB entries) |
![]() | Domain d3u6ba3: 3u6b A:297-393 [250089] Other proteins in same PDB: d3u6ba1, d3u6ba2, d3u6bb1, d3u6bb2 automated match to d1d8ta2 complexed with gdp, mg |
PDB Entry: 3u6b (more details), 2.12 Å
SCOPe Domain Sequences for d3u6ba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u6ba3 b.44.1.0 (A:297-393) automated matches {Escherichia coli K-12 [TaxId: 83333]} tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni kmvvtlihpiamddglrfaireggrtvgagvvakvlg
Timeline for d3u6ba3: