Lineage for d3u5rg_ (3u5r G:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1603211Species Sinorhizobium meliloti [TaxId:266834] [256114] (1 PDB entry)
  8. 1603214Domain d3u5rg_: 3u5r G: [250085]
    automated match to d2ywoa_

Details for d3u5rg_

PDB Entry: 3u5r (more details), 2.05 Å

PDB Description: Crystal structure of a hypothetical protein SMc02350 from Sinorhizobium meliloti 1021
PDB Compounds: (G:) Uncharacterized protein

SCOPe Domain Sequences for d3u5rg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u5rg_ c.47.1.0 (G:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
ktqsnsitlgtraadfvlpdaggnlftlaefkdspallvafisnrcpfvvlirealakfa
gdyagqglavvainsndaqafpeetlervgaevkaygygfpylkdasqsvakaygaactp
dfflydrerrlvyhgqfddarpgngkdvtgadlraavdavlkgkdvgttqvpsigcnikw
tagnepswf

SCOPe Domain Coordinates for d3u5rg_:

Click to download the PDB-style file with coordinates for d3u5rg_.
(The format of our PDB-style files is described here.)

Timeline for d3u5rg_: