Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (133 species) not a true protein |
Species Sinorhizobium meliloti [TaxId:266834] [256114] (1 PDB entry) |
Domain d3u5rg_: 3u5r G: [250085] automated match to d2ywoa_ |
PDB Entry: 3u5r (more details), 2.05 Å
SCOPe Domain Sequences for d3u5rg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u5rg_ c.47.1.0 (G:) automated matches {Sinorhizobium meliloti [TaxId: 266834]} ktqsnsitlgtraadfvlpdaggnlftlaefkdspallvafisnrcpfvvlirealakfa gdyagqglavvainsndaqafpeetlervgaevkaygygfpylkdasqsvakaygaactp dfflydrerrlvyhgqfddarpgngkdvtgadlraavdavlkgkdvgttqvpsigcnikw tagnepswf
Timeline for d3u5rg_: