Lineage for d3u35d_ (3u35 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792693Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1792694Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1792894Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 1792895Protein automated matches [190439] (19 species)
    not a true protein
  7. 1792970Species Xanthomonas axonopodis [TaxId:92829] [256113] (2 PDB entries)
  8. 1792974Domain d3u35d_: 3u35 D: [250082]
    automated match to d3dmbb_
    complexed with pge

Details for d3u35d_

PDB Entry: 3u35 (more details), 2.5 Å

PDB Description: crystal structure of the general stress fmn/fad binding protein from the phytopathogen xanthomonas citri
PDB Compounds: (D:) General stress protein

SCOPe Domain Sequences for d3u35d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u35d_ b.45.1.0 (D:) automated matches {Xanthomonas axonopodis [TaxId: 92829]}
tkelqekfwkalksdrtvmlgldgvedgharpmtaqiegdsggpiwfftskdnaliamlg
qgrrvigafsskghdlfasisgslredtdpamvdrlwnpyvaawyeggktdpnlallrld
adhaqiwlnessllagikvll

SCOPe Domain Coordinates for d3u35d_:

Click to download the PDB-style file with coordinates for d3u35d_.
(The format of our PDB-style files is described here.)

Timeline for d3u35d_: